Outdoor Full color LED Display LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Outdoor Fullcolor LED Display Outdoor Fullcolor LED Display Technical parameter Item P12.5 outdoor Pixel pitch 12.5mm Module size 200mm×100mm Density of pixel 6400dot/m2 Pix
Red color LED Signboard Display LED display sign board,out door led display message board,out door led display message board Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCa
Red color LED Sign Display LED Sign Display manufacturer Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCabinet Size: 320mm×320mm1024mm×768mm1152mm×864
inflatable light tower Description features: This portable inflatable light tower system is made up of special synthetic fabric cloth, which holds 400 Watt Metal Halide sou
Siemens PLC We agent for all the Siemens PLC! (Programmable Logic Controller
Red color LED Display sign board LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Outdoor Full color LED Display LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Outdoor Fullcolor LED Display Outdoor Fullcolor LED Display Technical parameter Item P12.5 outdoor Pixel pitch 12.5mm Module size 200mm×100mm Density of pixel 6400dot/m2 Pix
Red color LED Signboard Display LED display sign board,out door led display message board,out door led display message board Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCa
Red color LED Sign Display LED Sign Display manufacturer Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCabinet Size: 320mm×320mm1024mm×768mm1152mm×864
Red color LED Display sign board LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Outdoor Full color LED Display LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Outdoor Fullcolor LED Display Outdoor Fullcolor LED Display Technical parameter Item P12.5 outdoor Pixel pitch 12.5mm Module size 200mm×100mm Density of pixel 6400dot/m2 Pix
Red color LED Signboard Display LED display sign board,out door led display message board,out door led display message board Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCa
Red color LED Sign Display LED Sign Display manufacturer Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCabinet Size: 320mm×320mm1024mm×768mm1152mm×864
big-torsion wire arrangement special winding machi This equipment adopts computer CNC control operation and has a precise positioning of CPLD decoding speed testing for the main axis. It is equipped w
Firing system Firing system1.Temperature control of firing system consists of several temperature control groups. 2.Each temperature control group divides into up
Digital Voltage Stabilizing Vibratory Feeder Contr TheVibration Plate Controlleris specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic te
Intelligent Digital Variable Voltage Vibratory Fee The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Intelligent Dual Output Digital Variable Voltage V The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Intelligent Digital Variable Voltage Vibratory Fee The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Intelligent Digital Variable Voltage Vibratory Fee The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Intelligent Digital Variable Voltage Vibratory Fee The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Intelligent Dual Output Digital Variable Voltage V The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Intelligent Digital Variable Voltage and Variable The vibratory feeder controller controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest
Intelligent Digital Variable Voltage and Variable The vibratory feeder controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic
Intelligent Digital Variable Voltage and Variable The vibratory feeder controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic
line protection Line Proteciton Module Applications Transformer substation with 10KV, 35KV, 66KV or 110 KV Configuration of protection functions (1) Alarm control w
recloser module Configuration of Protection l Over current protection between phases l Grounded fault protection l Precautious fault protection Characteristics of Mo
neutral protection module Main Transformer Neutral Protection-965C l Neutral point zero-sequence over-current protection l Clearance zero-sequence over-current and overload pr
transformer protection Applications l Protection and measurement of 10KV/400V Y/YO Transformers Configuration of Protecting Functions l Quick break protection l Over curren
asynchronous motor protection, measurement & c WKT-F2-964 Protection, Measurement and ControlModule of Medium/Small Asynchronous Motor Applications Protection and measurement of small and medium m
Melt pump PLC control system SseriescontrolsystemisnewgenerationofPLCcontrolsystemwhichisspeciallydesignedformeltpumps. Industryleader Lowermaintenancerequirements Friendlyhuman-
Multi-functional anti-jamming device The magnetic litters in pipeline, such asscrap ironfall down in the deposition process, when passing by the anti-jamming tool adsorb magnetic litters
high frequency and medium frequency induction heat equipment typeDD-15IMaximum oscillating power15KVAInput voltage scopesingle phase 180V-245VInput voltage frequency50-60HZOutput oscillating frequency
alloy saw blades welding machine HIGH FREQUENCY INDUCTION HEATING MACHINE Equipment typeDD-04Maxium oscillating power4KVAInput voltage scopeSingle phase180-245VOutput oscillating fre
ultra-high frequency induction welding machine induction weldingmachine has many advantages: 1,low energy consumption 2,high production efficiency 3,easy operation 4,environment friendly. Main fea
high frequency induction quenching equipment Main parameters of this high frequency induction quenching equipment: Main Technical Parameters for Hi-frequency EquipmentModelDD-25JQDD-35DD-45Max o
HF/MF induction heat treatment equipment MAIN PARAMETERS OF THIS HF/MF INDUCTION HEAT TREATMENTEQUIPMENT: Equipment typeDD-70Maxium oscillating power75KVAInput voltage scopethree phase 340-4
precision stamping parts precision turned parts ,precisionstamping parts & assembly as per customer's drawings or samples
crankcase cover
slip ring The slip ring can be used in any electromechanical system that requires unrestrained, continuous ratation while transmitting power and data fron a st
GZZ100W Handy Elector -magnetic Induction Heater
Capacitor: 1.Name:Capacitor 2.capacitor for rectifier of metal halide 3.capacitor, aluminium electrolytic capacitor for rectifier of metal halide lamp Specifica
Super Audio induction heating equipment Super Audio induction heating equipment Main features: 1, the unique semiconductor solid-state high-frequency inverter control technology. 2, full po
Ehv Cold Pressure Machine Hydraulic System The system pressure highest to 300KG. Through pressurization the highest high pressure can reach 3000KG.The structural design novel, easy installatio
non-standard camera lens electric automation equip Umeki Precision Industry (Zhu Hai) CO., LTD. is a Foreign-founded enterprise,invested by Umeki lappingout CO.,LTD with the head office is in Japan an
4 axis dispensing robot 1.ApplicationUsed for any shape workpieces' adhesive dispensing.Work area can be 300mm*300mm.2.Features:X.Y.Z.U axes work together,can meet the need
3 axis dispensing machine 1.ApplicationUsed for any shape workpieces' adhesive dispensing.2.Features:.It was the smallest glue-dispensing robot which work area is 200mm..X,Y,Z
