Открытый полный цвет Светодиодный дисплей LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Открытый Полноцветный светодиодный дисплей Outdoor Fullcolor LED Display Technical parameter Item P12.5 outdoor Pixel pitch 12.5mm Module size 200mm×100mm Density of pixel 6400dot/m2 Pix
Красный цвет светодиодный Вывеска Показать LED display sign board,out door led display message board,out door led display message board Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCa
Красный светодиодный дисплей Войти LED Sign Display manufacturer Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCabinet Size: 320mm×320mm1024mm×768mm1152mm×864
надувная Световая башня Description features: This portable inflatable light tower system is made up of special synthetic fabric cloth, which holds 400 Watt Metal Halide sou
ПЛК Siemens We agent for all the Siemens PLC! (Programmable Logic Controller
Красный светодиодный дисплей вывеска LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Открытый полный цвет Светодиодный дисплей LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Открытый Полноцветный светодиодный дисплей Outdoor Fullcolor LED Display Technical parameter Item P12.5 outdoor Pixel pitch 12.5mm Module size 200mm×100mm Density of pixel 6400dot/m2 Pix
Красный цвет светодиодный Вывеска Показать LED display sign board,out door led display message board,out door led display message board Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCa
Красный светодиодный дисплей Войти LED Sign Display manufacturer Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCabinet Size: 320mm×320mm1024mm×768mm1152mm×864
Красный светодиодный дисплей вывеска LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Открытый полный цвет Светодиодный дисплей LED Display Item P16 outdoor Pixel pitch 16mm Module size 256mm×128mm Density of pixel 3906dot/m2 Pixel constitution 1R1G1B/2R1G1B LED encapsu-
Открытый Полноцветный светодиодный дисплей Outdoor Fullcolor LED Display Technical parameter Item P12.5 outdoor Pixel pitch 12.5mm Module size 200mm×100mm Density of pixel 6400dot/m2 Pix
Красный цвет светодиодный Вывеска Показать LED display sign board,out door led display message board,out door led display message board Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCa
Красный светодиодный дисплей Войти LED Sign Display manufacturer Item No PH10PH16PH18CabinetPixel Pitch : 10mm16mm18mmCabinet Size: 320mm×320mm1024mm×768mm1152mm×864
большой кручения проволоки договоренность специальный обмотки мати This equipment adopts computer CNC control operation and has a precise positioning of CPLD decoding speed testing for the main axis. It is equipped w
Увольнение система Firing system1.Temperature control of firing system consists of several temperature control groups. 2.Each temperature control group divides into up
Цифровой стабилизации напряжения вибрационного питателя Contr TheVibration Plate Controlleris specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic te
Интеллектуальные цифровые переменного напряжения Вибрационный Плата The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Интеллектуальный двойной выход цифровой Переменная Напряжение The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Интеллектуальные цифровые переменного напряжения Вибрационный Плата The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Интеллектуальные цифровые переменного напряжения Вибрационный Плата The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Интеллектуальные цифровые переменного напряжения Вибрационный Плата The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Интеллектуальный двойной выход цифровой Переменная Напряжение The controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic technology and e
Интеллектуальные цифровые переменного напряжения и переменной The vibratory feeder controller controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest
Интеллектуальные цифровые переменного напряжения и переменной The vibratory feeder controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic
Интеллектуальные цифровые переменного напряжения и переменной The vibratory feeder controller is specially designed for controlling vibratory feeder in the automation systems. Combined with the latest electronic
Защита линии Line Proteciton Module Applications Transformer substation with 10KV, 35KV, 66KV or 110 KV Configuration of protection functions (1) Alarm control w
Модуль автоматического повторного включения Configuration of Protection l Over current protection between phases l Grounded fault protection l Precautious fault protection Characteristics of Mo
Модуль защиты нейтрали Main Transformer Neutral Protection-965C l Neutral point zero-sequence over-current protection l Clearance zero-sequence over-current and overload pr
Защита трансформатора Applications l Protection and measurement of 10KV/400V Y/YO Transformers Configuration of Protecting Functions l Quick break protection l Over curren
асинхронный Защита двигателя, измерение и с WKT-F2-964 Protection, Measurement and ControlModule of Medium/Small Asynchronous Motor Applications Protection and measurement of small and medium m
Растопить насос системы управления PLC SseriescontrolsystemisnewgenerationofPLCcontrolsystemwhichisspeciallydesignedformeltpumps. Industryleader Lowermaintenancerequirements Friendlyhuman-
Многофункциональный анти-помех устройство The magnetic litters in pipeline, such asscrap ironfall down in the deposition process, when passing by the anti-jamming tool adsorb magnetic litters
высокая частота и средней частоты индукционного нагрева equipment typeDD-15IMaximum oscillating power15KVAInput voltage scopesingle phase 180V-245VInput voltage frequency50-60HZOutput oscillating frequency
Сплав пилы сварочный аппарат HIGH FREQUENCY INDUCTION HEATING MACHINE Equipment typeDD-04Maxium oscillating power4KVAInput voltage scopeSingle phase180-245VOutput oscillating fre
ультра-высокой частоты индукции сварочный аппарат induction weldingmachine has many advantages: 1,low energy consumption 2,high production efficiency 3,easy operation 4,environment friendly. Main fea
высокочастотного индукционного тушение оборудование Main parameters of this high frequency induction quenching equipment: Main Technical Parameters for Hi-frequency EquipmentModelDD-25JQDD-35DD-45Max o
ВЧ / MF индукции оборудование термообработки MAIN PARAMETERS OF THIS HF/MF INDUCTION HEAT TREATMENTEQUIPMENT: Equipment typeDD-70Maxium oscillating power75KVAInput voltage scopethree phase 340-4
точность штамповки частей precision turned parts ,precisionstamping parts & assembly as per customer's drawings or samples
картера крышка
держатель клиньев The slip ring can be used in any electromechanical system that requires unrestrained, continuous ratation while transmitting power and data fron a st
GZZ100W Handy курфюрста -Магнитный индукционный нагреватель
Конденсатор: 1.Name:Capacitor 2.capacitor for rectifier of metal halide 3.capacitor, aluminium electrolytic capacitor for rectifier of metal halide lamp Specifica
Super Audio индукционного нагрева оборудования Super Audio induction heating equipment Main features: 1, the unique semiconductor solid-state high-frequency inverter control technology. 2, full po
ЭВ холодного давления в гидравлической системе машины The system pressure highest to 300KG. Through pressurization the highest high pressure can reach 3000KG.The structural design novel, easy installatio
нестандартная объектив камеры электрическая автоматизация персонаже Umeki Precision Industry (Zhu Hai) CO., LTD. is a Foreign-founded enterprise,invested by Umeki lappingout CO.,LTD with the head office is in Japan an
4 оси робота дозирования 1.ApplicationUsed for any shape workpieces' adhesive dispensing.Work area can be 300mm*300mm.2.Features:X.Y.Z.U axes work together,can meet the need
3 оси дозирования машины 1.ApplicationUsed for any shape workpieces' adhesive dispensing.2.Features:.It was the smallest glue-dispensing robot which work area is 200mm..X,Y,Z
